DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL18A and AT1G29965

DIOPT Version :9

Sequence 1:NP_523774.1 Gene:RpL18A / 36985 FlyBaseID:FBgn0010409 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_849729.1 Gene:AT1G29965 / 839875 AraportID:AT1G29965 Length:178 Species:Arabidopsis thaliana


Alignment Length:172 Identity:89/172 - (51%)
Similarity:124/172 - (72%) Gaps:3/172 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LKEYEVVGRKLPSEKEPQTPLYKMRIFAPDNIVAKSRFWYFLRQLKKFKKTTGEIVSIKQVYETS 71
            |.:|:||||.||:||:.|..:|:|:::|.:.::|||:|||:||:.||.||:.|::::|.:::|.:
plant     6 LHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYYLRRQKKVKKSNGQMLAINEIFEKN 70

  Fly    72 PVKIKNFGIWLRYDSRSGTHNMYREYRDLTVGGAVTQCYRDMGARHRARAHSIQIIKVDSIPAAK 136
            |..||||||||||.||:|.||||:||||.|:.|||.|.|.:|.:|||.|...|||||..::||:.
plant    71 PTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPASL 135

  Fly   137 TRRVHVKQFHDSKIKFPLVQRVHHKGNRKL---FSFRKPRTY 175
            .:|...||||:||||||||.|......|||   |...||..:
plant   136 CKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTFKANKPNLF 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL18ANP_523774.1 RPL20A 69..153 CDD:225068 50/83 (60%)
AT1G29965NP_849729.1 Ribosomal_L18ae <85..129 CDD:250854 27/43 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 157 1.000 Domainoid score I1310
eggNOG 1 0.900 - - E1_COG2157
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68104
Inparanoid 1 1.050 190 1.000 Inparanoid score I1385
OMA 1 1.010 - - QHG53815
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002143
OrthoInspector 1 1.000 - - otm3470
orthoMCL 1 0.900 - - OOG6_101208
Panther 1 1.100 - - O PTHR10052
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1428
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.830

Return to query results.
Submit another query.