DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL18A and AT3G14600

DIOPT Version :9

Sequence 1:NP_523774.1 Gene:RpL18A / 36985 FlyBaseID:FBgn0010409 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_188078.1 Gene:AT3G14600 / 820688 AraportID:AT3G14600 Length:178 Species:Arabidopsis thaliana


Alignment Length:170 Identity:83/170 - (48%)
Similarity:119/170 - (70%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EYEVVGRKLPSEKEPQTPLYKMRIFAPDNIVAKSRFWYFLRQLKKFKKTTGEIVSIKQVYETSPV 73
            :|:||||.||:|.:....:|:|:::..:.:.|||:||||:|:|||.||:.|::::|.:::|.:|.
plant     8 QYQVVGRALPTENDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQMLAINEIFEKNPT 72

  Fly    74 KIKNFGIWLRYDSRSGTHNMYREYRDLTVGGAVTQCYRDMGARHRARAHSIQIIKVDSIPAAKTR 138
            .|||:||||||.||:|.||||:||||.|:.|.|.|.|.:|.:|||.|...|||||..::||...:
plant    73 TIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCK 137

  Fly   139 RVHVKQFHDSKIKFPLVQRVHHKGNRKL---FSFRKPRTY 175
            |...||||:||||||||.|.....:|||   :...||..:
plant   138 REITKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASKPNLF 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL18ANP_523774.1 RPL20A 69..153 CDD:225068 48/83 (58%)
AT3G14600NP_188078.1 Ribosomal_L18A 82..129 CDD:396369 28/46 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 157 1.000 Domainoid score I1310
eggNOG 1 0.900 - - E1_COG2157
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68104
Inparanoid 1 1.050 190 1.000 Inparanoid score I1385
OMA 1 1.010 - - QHG53815
OrthoDB 1 1.010 - - D1265349at2759
OrthoFinder 1 1.000 - - FOG0002143
OrthoInspector 1 1.000 - - otm3470
orthoMCL 1 0.900 - - OOG6_101208
Panther 1 1.100 - - O PTHR10052
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1428
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.