DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL18A and AT2G34480

DIOPT Version :9

Sequence 1:NP_523774.1 Gene:RpL18A / 36985 FlyBaseID:FBgn0010409 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001323764.1 Gene:AT2G34480 / 818011 AraportID:AT2G34480 Length:217 Species:Arabidopsis thaliana


Alignment Length:170 Identity:90/170 - (52%)
Similarity:123/170 - (72%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EYEVVGRKLPSEKEPQTPLYKMRIFAPDNIVAKSRFWYFLRQLKKFKKTTGEIVSIKQVYETSPV 73
            :|:||||.||:||:.|..:|:|:::|.:.:.|||:||||||:|||.||:.|::::|.::||.:|.
plant    47 QYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIYEKNPT 111

  Fly    74 KIKNFGIWLRYDSRSGTHNMYREYRDLTVGGAVTQCYRDMGARHRARAHSIQIIKVDSIPAAKTR 138
            .||||||||||.||:|.||||:||||.|:.|||.|.|.:|.:|||.|...|||||..::||...:
plant   112 TIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCK 176

  Fly   139 RVHVKQFHDSKIKFPLVQRVHHKGNRKL---FSFRKPRTY 175
            |...||||:||||||||.|.....:|||   :...||..:
plant   177 RESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKANKPNLF 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL18ANP_523774.1 RPL20A 69..153 CDD:225068 50/83 (60%)
AT2G34480NP_001323764.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 157 1.000 Domainoid score I1310
eggNOG 1 0.900 - - E1_COG2157
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68104
Inparanoid 1 1.050 190 1.000 Inparanoid score I1385
OMA 1 1.010 - - QHG53815
OrthoDB 1 1.010 - - D1265349at2759
OrthoFinder 1 1.000 - - FOG0002143
OrthoInspector 1 1.000 - - otm3470
orthoMCL 1 0.900 - - OOG6_101208
Panther 1 1.100 - - O PTHR10052
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1428
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.