DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL18A and rpl18a

DIOPT Version :9

Sequence 1:NP_523774.1 Gene:RpL18A / 36985 FlyBaseID:FBgn0010409 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001016690.1 Gene:rpl18a / 549444 XenbaseID:XB-GENE-5774784 Length:176 Species:Xenopus tropicalis


Alignment Length:176 Identity:120/176 - (68%)
Similarity:147/176 - (83%) Gaps:0/176 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAKGLLKEYEVVGRKLPSEKEPQTPLYKMRIFAPDNIVAKSRFWYFLRQLKKFKKTTGEIVSIK 65
            |:|.|.|:||:|:||.||:.|.|..|||:||||||:::|||||||||:.||||.||::||||...
 Frog     1 MKASGTLREYKVIGRSLPTPKAPSPPLYRMRIFAPNHVVAKSRFWYFVSQLKKMKKSSGEIVYCG 65

  Fly    66 QVYETSPVKIKNFGIWLRYDSRSGTHNMYREYRDLTVGGAVTQCYRDMGARHRARAHSIQIIKVD 130
            ||||.:|:|:||||||||||||||||||||||||||...||||||||||||||||||:|||:||:
 Frog    66 QVYEKTPLKVKNFGIWLRYDSRSGTHNMYREYRDLTTAAAVTQCYRDMGARHRARAHAIQIMKVE 130

  Fly   131 SIPAAKTRRVHVKQFHDSKIKFPLVQRVHHKGNRKLFSFRKPRTYF 176
            .|||:|.||..:||||||||||||..||..:.::..|:.::|.|:|
 Frog   131 VIPASKCRRPAIKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL18ANP_523774.1 RPL20A 69..153 CDD:225068 67/83 (81%)
rpl18aNP_001016690.1 RPL20A 72..153 CDD:225068 66/80 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 204 1.000 Domainoid score I2883
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68104
Inparanoid 1 1.050 260 1.000 Inparanoid score I3037
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1265349at2759
OrthoFinder 1 1.000 - - FOG0002143
OrthoInspector 1 1.000 - - oto104205
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1116
SonicParanoid 1 1.000 - - X1428
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.