DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL18A and RGD1565566

DIOPT Version :9

Sequence 1:NP_523774.1 Gene:RpL18A / 36985 FlyBaseID:FBgn0010409 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_038953018.1 Gene:RGD1565566 / 499057 RGDID:1565566 Length:182 Species:Rattus norvegicus


Alignment Length:172 Identity:112/172 - (65%)
Similarity:137/172 - (79%) Gaps:0/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GLLKEYEVVGRKLPSEKEPQTPLYKMRIFAPDNIVAKSRFWYFLRQLKKFKKTTGEIVSIKQVYE 69
            |.|:||::|||.||:.|....|||:||||||:::||||.||:|:.||||.||::||||...||:|
  Rat    11 GTLREYKMVGRCLPTPKCHSPPLYRMRIFAPNHVVAKSGFWHFVSQLKKMKKSSGEIVYCGQVFE 75

  Fly    70 TSPVKIKNFGIWLRYDSRSGTHNMYREYRDLTVGGAVTQCYRDMGARHRARAHSIQIIKVDSIPA 134
            .||:::|||||||||||||||||||||||.||..|.|||||:||||||.||||||||:||..|.|
  Rat    76 KSPLRVKNFGIWLRYDSRSGTHNMYREYRYLTTAGLVTQCYQDMGARHCARAHSIQIMKVVEIAA 140

  Fly   135 AKTRRVHVKQFHDSKIKFPLVQRVHHKGNRKLFSFRKPRTYF 176
            .|.||..|||||||||||||..||..:.::..|:.::|.|:|
  Rat   141 GKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTIKRPNTFF 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL18ANP_523774.1 RPL20A 69..153 CDD:225068 65/83 (78%)
RGD1565566XP_038953018.1 RPL20A 75..159 CDD:225068 65/83 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352679
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10052
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.