DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL18A and Rpl18a

DIOPT Version :9

Sequence 1:NP_523774.1 Gene:RpL18A / 36985 FlyBaseID:FBgn0010409 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_997675.1 Gene:Rpl18a / 290641 RGDID:1302976 Length:176 Species:Rattus norvegicus


Alignment Length:176 Identity:121/176 - (68%)
Similarity:145/176 - (82%) Gaps:0/176 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAKGLLKEYEVVGRKLPSEKEPQTPLYKMRIFAPDNIVAKSRFWYFLRQLKKFKKTTGEIVSIK 65
            |:|.|.|:||:||||.||:.|....|||:||||||:::|||||||||:.||||.||::||||...
  Rat     1 MKASGTLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFWYFVSQLKKMKKSSGEIVYCG 65

  Fly    66 QVYETSPVKIKNFGIWLRYDSRSGTHNMYREYRDLTVGGAVTQCYRDMGARHRARAHSIQIIKVD 130
            ||:|.||:::||||||||||||||||||||||||||..|||||||||||||||||||||||:||:
  Rat    66 QVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVE 130

  Fly   131 SIPAAKTRRVHVKQFHDSKIKFPLVQRVHHKGNRKLFSFRKPRTYF 176
            .|.|.|.||..|||||||||||||..||..:.::..|:.::|.|:|
  Rat   131 EIAAGKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL18ANP_523774.1 RPL20A 69..153 CDD:225068 69/83 (83%)
Rpl18aNP_997675.1 RPL20A 69..153 CDD:225068 69/83 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352678
Domainoid 1 1.000 200 1.000 Domainoid score I2948
eggNOG 1 0.900 - - E1_COG2157
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68104
Inparanoid 1 1.050 253 1.000 Inparanoid score I3121
OMA 1 1.010 - - QHG53815
OrthoDB 1 1.010 - - D1265349at2759
OrthoFinder 1 1.000 - - FOG0002143
OrthoInspector 1 1.000 - - otm45689
orthoMCL 1 0.900 - - OOG6_101208
Panther 1 1.100 - - LDO PTHR10052
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1428
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.