DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL18A and rpl2001

DIOPT Version :9

Sequence 1:NP_523774.1 Gene:RpL18A / 36985 FlyBaseID:FBgn0010409 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_593336.1 Gene:rpl2001 / 2542725 PomBaseID:SPAC3A12.10 Length:176 Species:Schizosaccharomyces pombe


Alignment Length:174 Identity:93/174 - (53%)
Similarity:123/174 - (70%) Gaps:4/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LKEYEVVGRKLPSEKEPQTPLYKMRIFAPDNIVAKSRFWYFLRQLKKFKKTTGEIVSIKQVYETS 71
            ||||:|||||:|:|.||...|::||:|||:..|||||:||||:.:.|.||.|||||:|.::.|..
pombe     3 LKEYQVVGRKVPTEHEPVPKLFRMRLFAPNESVAKSRYWYFLKMINKVKKATGEIVAINEISEPK 67

  Fly    72 PVKIKNFGIWLRYDSRSGTHNMYREYRDLTVGGAVTQCYRDMGARHRARAHSIQIIKVDSIPAAK 136
            |:|.|.||||:||||||||||||:|:||.|..|||...|.||.||||||..||:|:||..:...:
pombe    68 PLKAKVFGIWIRYDSRSGTHNMYKEFRDTTRVGAVEAMYADMAARHRARFRSIRILKVVEVEKKE 132

  Fly   137 -TRRVHVKQFHDSKIKFPLVQR---VHHKGNRKLFSFRKPRTYF 176
             .||.:|||..:..:||||..|   |.....:|:|:..:|.|::
pombe   133 DVRRNYVKQLLNPHLKFPLPHRRTGVVGLAGKKVFAPHRPSTFY 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL18ANP_523774.1 RPL20A 69..153 CDD:225068 47/84 (56%)
rpl2001NP_593336.1 RPL20A 65..150 CDD:225068 47/84 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 168 1.000 Domainoid score I916
eggNOG 1 0.900 - - E1_COG2157
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68104
Inparanoid 1 1.050 185 1.000 Inparanoid score I1082
OMA 1 1.010 - - QHG53815
OrthoFinder 1 1.000 - - FOG0002143
OrthoInspector 1 1.000 - - otm47297
orthoMCL 1 0.900 - - OOG6_101208
Panther 1 1.100 - - LDO PTHR10052
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1428
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.