DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL18A and rpl-20

DIOPT Version :9

Sequence 1:NP_523774.1 Gene:RpL18A / 36985 FlyBaseID:FBgn0010409 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001294214.1 Gene:rpl-20 / 24104384 WormBaseID:WBGene00004432 Length:180 Species:Caenorhabditis elegans


Alignment Length:179 Identity:104/179 - (58%)
Similarity:137/179 - (76%) Gaps:3/179 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAKGL---LKEYEVVGRKLPSEKEPQTPLYKMRIFAPDNIVAKSRFWYFLRQLKKFKKTTGEIV 62
            |..|.|   |.||.|||||:|:||||.||::||:|||.::::||||||||:..|::.||..|||:
 Worm     1 MPTKALGETLNEYVVVGRKIPTEKEPVTPIWKMQIFATNHVIAKSRFWYFVSMLRRVKKANGEIL 65

  Fly    63 SIKQVYETSPVKIKNFGIWLRYDSRSGTHNMYREYRDLTVGGAVTQCYRDMGARHRARAHSIQII 127
            |||||:|.:|..:||:|:||:||||:|.|||||||||.||.||||||||||||||||:|..|.|:
 Worm    66 SIKQVFEKNPGTVKNYGVWLKYDSRTGHHNMYREYRDTTVAGAVTQCYRDMGARHRAQADRIHIL 130

  Fly   128 KVDSIPAAKTRRVHVKQFHDSKIKFPLVQRVHHKGNRKLFSFRKPRTYF 176
            ||.::.|..|:|..:|.|||:||:|||..||..:.|..:|:..:..|:|
 Worm   131 KVQTVKAEDTKRAGIKMFHDAKIRFPLPHRVTKRKNLSVFTTARQNTHF 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL18ANP_523774.1 RPL20A 69..153 CDD:225068 53/83 (64%)
rpl-20NP_001294214.1 Ribosomal_L18ae <88..132 CDD:250854 34/43 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166220
Domainoid 1 1.000 186 1.000 Domainoid score I2005
eggNOG 1 0.900 - - E1_COG2157
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I2246
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53815
OrthoDB 1 1.010 - - D1265349at2759
OrthoFinder 1 1.000 - - FOG0002143
OrthoInspector 1 1.000 - - oto19609
orthoMCL 1 0.900 - - OOG6_101208
Panther 1 1.100 - - LDO PTHR10052
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1116
SonicParanoid 1 1.000 - - X1428
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.