DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and ppiA

DIOPT Version :10

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_417822.1 Gene:ppiA / 947870 ECOCYCID:EG10757 Length:190 Species:Escherichia coli


Alignment Length:183 Identity:58/183 - (31%)
Similarity:82/183 - (44%) Gaps:32/183 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 PAVIEKAEKRNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVI 192
            ||.:  |.|.:|.|...     ..||.|.:.|.....|.:.:||....  ..|: |...:|||||
E. coli    20 PAAM--AAKGDPHVLLT-----TSAGNIELELDKQKAPVSVQNFVDYV--NSGF-YNNTTFHRVI 74

  Fly   193 PEFMCQGGDFTNNNGTGGKSIYGKKFN----DENFNLKHNSFGTLSMANSGANTNG-SQFFICTT 252
            |.||.|||.||       :.:..||.|    :|..|...|:.||::||.:....:. |||||...
E. coli    75 PGFMIQGGGFT-------EQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVA 132

  Fly   253 KTDWLDN-----KHVVFGHVISGAEVVRKMER-----CGSKSGTPSQKIVIYS 295
            ...:||:     .:.|||.|:.|.:|..|:.:     .|.....||:.:||.|
E. coli   133 DNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..82 CDD:409783
cyclophilin_ABH_like 139..297 CDD:238907 54/172 (31%)
ppiANP_417822.1 PRK10903 1..190 CDD:182824 58/183 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.