DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and CPR2

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_011924.1 Gene:CPR2 / 856454 SGDID:S000001099 Length:205 Species:Saccharomyces cerevisiae


Alignment Length:175 Identity:89/175 - (50%)
Similarity:108/175 - (61%) Gaps:3/175 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 GPAVIEKAEKRNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQG-YGYKGCSFHR 190
            |..:.:..|....:|||||..|....||||:.|...|.||||:||.:|.|.... .|:.|.:|||
Yeast    24 GELIDQDDEVITQKVFFDIEHGEEKVGRIVIGLYGKVCPKTAKNFYKLSTTTNSKKGFIGSTFHR 88

  Fly   191 VIPEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTT-KT 254
            |||.||.||||||:..|.|||||||..|.||||.|||:..|.|||||.|.:||||||||.|| :.
Yeast    89 VIPNFMVQGGDFTDGTGVGGKSIYGDTFPDENFTLKHDRKGRLSMANRGKDTNGSQFFITTTEEA 153

  Fly   255 DWLDNKHVVFGHVISGAEVVRKMERCG-SKSGTPSQKIVIYSCGE 298
            .|||.||||||.|:.|.:||..::... ..:..|.:.:.|..|||
Yeast   154 SWLDGKHVVFGQVVDGMDVVNYIQHVSRDANDKPLEAVKIAKCGE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 84/160 (53%)
CPR2NP_011924.1 cyclophilin 37..197 CDD:412213 84/159 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.