DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and CPR8

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_014425.3 Gene:CPR8 / 855762 SGDID:S000005311 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:187 Identity:49/187 - (26%)
Similarity:81/187 - (43%) Gaps:36/187 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 IEKAEKRNPQVFFDIRIG--------GNDAGRIVML-LRADVVPKTAENFRQLCTHEQGYGYKGC 186
            ::|....:|.:..::.||        ..:|||::.: |...:||||...|   |.:......:..
Yeast    36 LKKKYAPDPPITHNVNIGIVFTDPESSEEAGRLITIDLYGTMVPKTVMTF---CQYVDSVKDRLA 97

  Fly   187 SFHRVIPEFMCQGGDFTN---NNGTGGKSI----------YGKKFNDENFNLKHNSFGTLSMANS 238
            |.|...||     .||..   |....|.|:          ...|..:||.:|.|:..|.:||.. 
Yeast    98 SRHSYSPE-----RDFDKILPNGAIEGSSVSSSSIEETEMLAPKLPEENHSLIHDRPGRVSMIK- 156

  Fly   239 GANTNGSQFFICTTKTDWLDNKHVVFGHVISG-AEVVRKMERCGS-KSGTPSQKIVI 293
              :..|.:|.|.|::|. |:.:.||||.|.:| .:::.|:....: ::|.|.|.|.|
Yeast   157 --DDKGLKFIIETSETP-LEGESVVFGQVTAGLKDLMDKLANVKTDENGKPEQPITI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 48/179 (27%)
CPR8NP_014425.3 cyclophilin 65..210 CDD:412213 44/156 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.