DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and CPR3

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_013633.1 Gene:CPR3 / 854897 SGDID:S000004543 Length:182 Species:Saccharomyces cerevisiae


Alignment Length:166 Identity:97/166 - (58%)
Similarity:113/166 - (68%) Gaps:0/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 AEKRNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQ 198
            |.:...:||||..:.|...|||...|..:||||||||||.|||.|:|:||||..|||:||:||.|
Yeast    17 ASRLGKKVFFDPAVNGTKIGRIEFELYDNVVPKTAENFRALCTGEKGWGYKGVPFHRIIPDFMIQ 81

  Fly   199 GGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVV 263
            |||....||.|||||||.||.||||..||:..|.|||||:|.|||||||||.|....|||.||||
Yeast    82 GGDTDLTNGFGGKSIYGSKFADENFVKKHDKAGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVV 146

  Fly   264 FGHVISGAEVVRKMERCGSKSGTPSQKIVIYSCGEL 299
            ||.|..|.::|:.:|..|:.||.|..:|||...|||
Yeast   147 FGEVTKGMDIVKAIESYGTASGKPRAEIVIEEAGEL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 93/157 (59%)
CPR3NP_013633.1 cyclophilin_ABH_like 23..180 CDD:238907 93/156 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343459
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.