DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and CPR4

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_009995.1 Gene:CPR4 / 850433 SGDID:S000000665 Length:318 Species:Saccharomyces cerevisiae


Alignment Length:205 Identity:65/205 - (31%)
Similarity:85/205 - (41%) Gaps:42/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VRVKEDSFKPIWADDDWLQKHAGATLQPEGEPEAEKVETPST--GPAVIEKAEKRNPQVFFDIRI 147
            |.....|.|.|.:.|        ..||.:.||     ..|:|  |...||         :||...
Yeast    18 VHAAPSSGKQITSKD--------VDLQKKYEP-----SPPATHRGIITIE---------YFDPVS 60

  Fly   148 GGNDAGRIVMLLRADVVPKTAENFRQLCTHEQG------------YGYKGCSFHRVIPEFMCQGG 200
            .......:...|...|||||..||..|....:.            |.|:....::|.|....|||
Yeast    61 KSMKEADLTFELYGTVVPKTVNNFAMLAHGVKAVIEGKDPNDIHTYSYRKTKINKVYPNKYIQGG 125

  Fly   201 DFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDW---LDNKHV 262
            ....:  .|..::||.||:||||.|||:....|:||..|.::|.|:|.| |||.|.   ||.|.|
Yeast   126 VVAPD--VGPFTVYGPKFDDENFYLKHDRPERLAMAYFGPDSNTSEFII-TTKADGNEELDGKSV 187

  Fly   263 VFGHVISGAE 272
            |||.:.||.:
Yeast   188 VFGQITSGLD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 51/149 (34%)
CPR4NP_009995.1 cyclophilin 67..219 CDD:238194 49/134 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.