DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and ATE1

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_563931.2 Gene:ATE1 / 837930 AraportID:AT1G13690 Length:177 Species:Arabidopsis thaliana


Alignment Length:149 Identity:61/149 - (40%)
Similarity:91/149 - (61%) Gaps:14/149 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KRTIYVGGLADEVTERLLNNAFIPFGDIADIQMPADYESQRHRGFAFIEYEQSEDAAAAIDNMND 69
            |.|:|||||||||.|.:|:.||||||||.|::.|.|..:|:||.|.|:.:.:.|||:||:|||:.
plant    12 KNTLYVGGLADEVNESILHAAFIPFGDIKDVKTPLDQANQKHRSFGFVTFLEREDASAAMDNMDG 76

  Fly    70 SELCGRTIRVNLAKPVRVK--EDSF--KPIWAD-DDWLQKHAGATLQPEGEPEAEKVETPSTGPA 129
            :||.||.:.||.|.|.::|  |..:  .|:||| |.|.::.         :.|.|.::..:...|
plant    77 AELYGRVLTVNYALPEKIKGGEQGWAAHPLWADADTWFERQ---------QQEKEILKMQAENKA 132

  Fly   130 VIEKAEKRNPQVFFDIRIG 148
            .:|.||:.:.:...:.|.|
plant   133 AMETAEELHRKKLAEDRQG 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793 39/71 (55%)
cyclophilin_ABH_like 139..297 CDD:238907 2/10 (20%)
ATE1NP_563931.2 RRM_PPIE 15..89 CDD:409783 41/73 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 88 1.000 Domainoid score I2732
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1484092at2759
OrthoFinder 1 1.000 - - FOG0004615
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.