DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and AT2G38730

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_181407.1 Gene:AT2G38730 / 818455 AraportID:AT2G38730 Length:199 Species:Arabidopsis thaliana


Alignment Length:187 Identity:103/187 - (55%)
Similarity:118/187 - (63%) Gaps:11/187 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 PSTGPAVIE----KAEKRNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHE-----Q 179
            ||:|...:|    ....:||.||||:.|||..||||.|.|.||:.|||||||||.||.|     :
plant    13 PSSGGGNVEWHVRPPNPKNPVVFFDVSIGGIPAGRIKMELFADIAPKTAENFRQFCTGELRKAGK 77

  Fly   180 GYGYKGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNG 244
            ..|||.|.|||||.:||.|.|||..|:|:|..||||.||.||||..||...|.|||||||.||||
plant    78 PLGYKECQFHRVIKDFMVQSGDFLKNDGSGCMSIYGHKFEDENFTAKHTGPGLLSMANSGPNTNG 142

  Fly   245 SQFFICTTKTDWLDNKHVVFGHVI-SGAEVVRKMERCG-SKSGTPSQKIVIYSCGEL 299
            .||||...|.|||||||||||.|: .|..|:||:|... ..:..|...:||..|||:
plant   143 CQFFITCAKCDWLDNKHVVFGRVLGDGLLVMRKIENVAIGPNNRPKLAVVITECGEM 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 95/164 (58%)
AT2G38730NP_181407.1 PLN03149 14..199 CDD:178694 101/184 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.