DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and PPIAL4E

DIOPT Version :10

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001137504.2 Gene:PPIAL4E / 730262 HGNCID:33997 Length:164 Species:Homo sapiens


Alignment Length:161 Identity:95/161 - (59%)
Similarity:110/161 - (68%) Gaps:0/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 NPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQGGDF 202
            |..|||:|...|...|||.:.|.||.:||||||||.|.|.|:|:.|||..|||:||.||||||||
Human     3 NSVVFFEITRDGKPLGRISIKLFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDF 67

  Fly   203 TNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVVFGHV 267
            |..||||.|||||:||:|||...||...|.|||||:|.||||||||||..||:|||.|||.||.|
Human    68 TRPNGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICAAKTEWLDGKHVAFGKV 132

  Fly   268 ISGAEVVRKMERCGSKSGTPSQKIVIYSCGE 298
            .....:|..||..|.::...|:||.|..||:
Human   133 KERVNIVEAMEHFGYRNSKTSKKITIADCGQ 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..82 CDD:409783
cyclophilin_ABH_like 139..297 CDD:238907 92/157 (59%)
PPIAL4ENP_001137504.2 cyclophilin 4..162 CDD:469651 92/157 (59%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.