DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and Ppil3

DIOPT Version :10

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_011236892.1 Gene:Ppil3 / 70225 MGIID:1917475 Length:176 Species:Mus musculus


Alignment Length:119 Identity:60/119 - (50%)
Similarity:70/119 - (58%) Gaps:5/119 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 DAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYG 215
            |.|.|.:.:..:..|||.|||..||....   |.||.|||.|..||.|.||.| ..|.||.||:.
Mouse     8 DVGDIKIEVFCERTPKTCENFLALCASNY---YNGCVFHRNIKGFMVQTGDPT-GTGRGGSSIWA 68

  Fly   216 KKFNDE-NFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVVFGHVI 268
            |||.|| :..||||..|.:||||:|.|||||||||...|...||.|:.|||.::
Mouse    69 KKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKLL 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..82 CDD:409783
cyclophilin_ABH_like 139..297 CDD:238907 60/119 (50%)
Ppil3XP_011236892.1 Cyclophilin_PPIL3_like 1..>122 CDD:238909 60/117 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.