DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and RANBP2

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_005264059.1 Gene:RANBP2 / 5903 HGNCID:9848 Length:3258 Species:Homo sapiens


Alignment Length:243 Identity:101/243 - (41%)
Similarity:138/243 - (56%) Gaps:38/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 KPVRVKEDSFKPIWADDDWLQKHAGATLQPEGEPEAEKV----ETPSTGPA-------------- 129
            ||:.|..::.  :|...|:          .:||.:.|::    :|......              
Human  3028 KPLNVSNNAL--VWTASDY----------ADGEAKVEQLAVRFKTKEVADCFKKTFEECQQNLMK 3080

  Fly   130 --------VIEKAEKRNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGC 186
                    ..|.:::.||.||||:...|...|||.|.|.:::||:||||||.|||.|:|:|:|..
Human  3081 LQKGHVSLAAELSKETNPVVFFDVCADGEPLGRITMELFSNIVPRTAENFRALCTGEKGFGFKNS 3145

  Fly   187 SFHRVIPEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICT 251
            .||||||:|:|||||.|.::||||:||||.||.||||::||...|.|||||.|.|||.|||.|..
Human  3146 IFHRVIPDFVCQGGDITKHDGTGGQSIYGDKFEDENFDVKHTGPGLLSMANQGQNTNNSQFVITL 3210

  Fly   252 TKTDWLDNKHVVFGHVISGAEVVRKMERCGSKSGTPSQKIVIYSCGEL 299
            .|.:.||.||||||.|..|.:.|:|:|..||..|:..::|.|..||::
Human  3211 KKAEHLDFKHVVFGFVKDGMDTVKKIESFGSPKGSVCRRITITECGQI 3258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 88/157 (56%)
RANBP2XP_005264059.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.