DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and PPIC

DIOPT Version :10

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_000934.1 Gene:PPIC / 5480 HGNCID:9256 Length:212 Species:Homo sapiens


Alignment Length:152 Identity:93/152 - (61%)
Similarity:104/152 - (68%) Gaps:7/152 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 GPAVIEKAEKRNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRV 191
            ||:|..|       ||||:|||..|.||||:.|...|||||.|||..|.|.|:||||||..||||
Human    33 GPSVTAK-------VFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRV 90

  Fly   192 IPEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDW 256
            |.:||.||||.|..:||||.||||:.|.||||.|||...|.:||||:|.:||||||||..||..|
Human    91 IKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTW 155

  Fly   257 LDNKHVVFGHVISGAEVVRKME 278
            ||.||||||.||.|..||..:|
Human   156 LDGKHVVFGKVIDGMTVVHSIE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..82 CDD:409783
cyclophilin_ABH_like 139..297 CDD:238907 89/140 (64%)
PPICNP_000934.1 cyclophilin 39..197 CDD:469651 90/146 (62%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.