DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and PPIL1

DIOPT Version :10

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_057143.1 Gene:PPIL1 / 51645 HGNCID:9260 Length:166 Species:Homo sapiens


Alignment Length:140 Identity:64/140 - (45%)
Similarity:83/140 - (59%) Gaps:10/140 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 PQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQGGDFT 203
            |.|:.:     ...|.||:.|.....|||.:||.:|.  .:|| |.|..|||:|.:||.||||.|
Human    12 PNVYLE-----TSMGIIVLELYWKHAPKTCKNFAELA--RRGY-YNGTKFHRIIKDFMIQGGDPT 68

  Fly   204 NNNGTGGKSIYGKKFNDE-NFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVVFGHV 267
             ..|.||.|||||:|.|| :.:||....|.|:|||:|.:|||||||:....|.|||.||.:||.|
Human    69 -GTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRV 132

  Fly   268 ISGAEVVRKM 277
            ..|..:|.::
Human   133 CQGIGMVNRV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..82 CDD:409783
cyclophilin_ABH_like 139..297 CDD:238907 64/140 (46%)
PPIL1NP_057143.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 62/137 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.