DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and ppil3

DIOPT Version :10

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001004983.1 Gene:ppil3 / 448435 XenbaseID:XB-GENE-957807 Length:161 Species:Xenopus tropicalis


Alignment Length:146 Identity:66/146 - (45%)
Similarity:83/146 - (56%) Gaps:7/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 DAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYG 215
            |.|.|.:.|..:..||.:|||..||....   |.||.|||.|..||.|.||.| ..|.||:||:|
 Frog     8 DLGEIKIELFCERAPKASENFLALCASNY---YTGCLFHRNIKGFMVQTGDPT-GTGKGGQSIWG 68

  Fly   216 KKFNDENFN-LKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVVFGHVISGAEVVRKMER 279
            :||.||... |||:..|.:||||:|.|||.|||||...|...||.|:.|||.||.|.:.:.::|:
 Frog    69 RKFEDEYSEFLKHSVRGVVSMANNGPNTNASQFFITYGKQPHLDMKYTVFGKVIDGLDTLDELEK 133

  Fly   280 --CGSKSGTPSQKIVI 293
              ...||..|..::.|
 Frog   134 LPVHEKSFRPLTEVRI 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..82 CDD:409783
cyclophilin_ABH_like 139..297 CDD:238907 66/146 (45%)
ppil3NP_001004983.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 66/146 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.