DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and ppil3

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001002146.1 Gene:ppil3 / 415236 ZFINID:ZDB-GENE-040625-159 Length:161 Species:Danio rerio


Alignment Length:130 Identity:60/130 - (46%)
Similarity:78/130 - (60%) Gaps:5/130 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 DAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYG 215
            |.|.:.:.|..:..||:.|||..||.   |..|.||.|||.|..|:.|.||.| ..|.||.||:|
Zfish     8 DLGDMKIELFCEKAPKSCENFLALCA---GGFYNGCIFHRNIKGFIVQTGDPT-GTGKGGTSIWG 68

  Fly   216 KKFNDE-NFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVVFGHVISGAEVVRKMER 279
            :||.|| :.:||||..|.::|||:|.|||.||||....|...||.|:.|||.:|.|.|.:.::|:
Zfish    69 RKFEDEFSEHLKHNVRGVVAMANNGPNTNASQFFFTYAKQPHLDMKYTVFGKIIDGLETLDEIEK 133

  Fly   280  279
            Zfish   134  133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 60/130 (46%)
ppil3NP_001002146.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 60/130 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.