DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and CG7768

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster


Alignment Length:161 Identity:114/161 - (70%)
Similarity:129/161 - (80%) Gaps:0/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 PQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQGGDFT 203
            |:|:|||..||...|||||.||:|||||||||||.|||.|:||||||..||||||.|||||||||
  Fly     4 PRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFT 68

  Fly   204 NNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVVFGHVI 268
            |.|||||:||||.||.||||.|||...|.|||||:|||||||||||||.||.||||||||||.|:
  Fly    69 NQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVV 133

  Fly   269 SGAEVVRKMERCGSKSGTPSQKIVIYSCGEL 299
            .|.::|:|:|..||:.|..|:|::|..||.|
  Fly   134 EGMDIVQKVESYGSQDGKTSKKVIIEDCGAL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 111/157 (71%)
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 111/157 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447235
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D121127at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.