DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and ppil2

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_957285.2 Gene:ppil2 / 393966 ZFINID:ZDB-GENE-040426-1096 Length:524 Species:Danio rerio


Alignment Length:330 Identity:108/330 - (32%)
Similarity:145/330 - (43%) Gaps:71/330 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NDKRTIYVGGLADEVTERLLNNAFIPF--GDIADIQMPADYESQRHRGFAFIEYEQSEDAAAAID 65
            |.|...|...|.||           ||  .|:..:|.|.:.:......|..::           :
Zfish   135 NIKTKSYKDLLTDE-----------PFTRQDLITLQDPTNLDKFNVSNFFHVK-----------N 177

  Fly    66 NMN----DSELCGRTIRVNLAKPVRVKEDSFKPIWAD---DDWLQKHAGATLQPEGEPEAEKVET 123
            ||.    |.|...:....:|........::...::.|   |:.|    .:|::   ||||:|.:.
Zfish   178 NMKVLDPDEEKAKQDPSYHLKSTNLETRETLAELYRDYKGDELL----ASTMK---EPEAKKTDK 235

  Fly   124 -----PSTG------------PAVIEKAEK-RNPQVFFD-------IRIGGNDAGRIVMLLRADV 163
                 .|||            ||...:|:. .:..|.:.       :|:..| .|.:.:.|..|.
Zfish   236 FNAAHYSTGRVSASFTSTAMAPATNHEADAIADDAVRYQYVKKKGYVRLHTN-KGDLNVELHCDK 299

  Fly   164 VPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYGKKFNDE-NFNLKH 227
            |||..|||.:||  ::|| |.|..|||.|..||.||||.| ..||||:|.:||.|.|| ..||.|
Zfish   300 VPKAGENFIKLC--KKGY-YDGTVFHRSIRNFMIQGGDPT-GTGTGGESFWGKPFKDEFRPNLSH 360

  Fly   228 NSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVVFGHVISGAEVVRKMERCGS--KSGTPSQK 290
            ...|.|||||||.|||.|||||......:||.||.|||.|:.|.|.:..||...|  |:..|..:
Zfish   361 TGRGILSMANSGPNTNKSQFFITFRSCAYLDRKHSVFGRVVGGLETLSAMENVESDPKTDKPKSE 425

  Fly   291 IVIYS 295
            |.|.|
Zfish   426 IKILS 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793 14/77 (18%)
cyclophilin_ABH_like 139..297 CDD:238907 76/167 (46%)
ppil2NP_957285.2 Ubox 42..96 CDD:128780
cyclophilin_RING 281..440 CDD:238904 75/155 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.