DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and CG3511

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001286847.1 Gene:CG3511 / 37926 FlyBaseID:FBgn0035027 Length:637 Species:Drosophila melanogaster


Alignment Length:139 Identity:74/139 - (53%)
Similarity:83/139 - (59%) Gaps:7/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYGKK 217
            |.|.|.|....||||.|||   |.|.:...|.|..|||||..||.|.||.| ..|||||||:|..
  Fly   491 GDIHMRLFFKEVPKTVENF---CVHAKNGYYNGHIFHRVIKGFMVQTGDPT-GTGTGGKSIWGSD 551

  Fly   218 FNDENF-NLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVVFGHVISGAEVVRKMERCG 281
            |.||.. :|||:...|:||||:|.|||||||||....|.||||||.|||.|..|.|||  :..|.
  Fly   552 FKDEFVPSLKHDRPYTVSMANAGPNTNGSQFFITVLPTPWLDNKHTVFGRVYRGMEVV--LNICN 614

  Fly   282 SKSGTPSQK 290
            ||:...:.|
  Fly   615 SKANPKTDK 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 74/139 (53%)
CG3511NP_001286847.1 WD40 <75..>312 CDD:225201
WD40 <79..300 CDD:295369
WD40 repeat 85..122 CDD:293791
WD40 repeat 128..176 CDD:293791
WD40 repeat 181..210 CDD:293791
WD40 repeat 218..268 CDD:293791
WD40 repeat 275..311 CDD:293791
cyclophilin_WD40 485..633 CDD:238908 74/139 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447231
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.