DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and Ppih

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_003750067.2 Gene:Ppih / 366461 RGDID:1564921 Length:177 Species:Rattus norvegicus


Alignment Length:168 Identity:97/168 - (57%)
Similarity:116/168 - (69%) Gaps:6/168 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 NPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHE---QG--YGYKGCSFHRVIPEFMC 197
            ||.||||:.|||.:.||:.:.|.|||||||||||||.||.|   .|  .||||.:|||||.:||.
  Rat    10 NPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMI 74

  Fly   198 QGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHV 262
            |||||.|.:|||..|||...|.||||.|:|::.|.|||||||.:|||.||||..:|.||||.|||
  Rat    75 QGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHV 139

  Fly   263 VFGHVISGAEVVRKMERCGS-KSGTPSQKIVIYSCGEL 299
            |||.:|.|..|:||:|...: .:..|...:||..|||:
  Rat   140 VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 93/163 (57%)
PpihXP_003750067.2 cyclophilin 8..177 CDD:412213 96/166 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.