Sequence 1: | NP_523773.1 | Gene: | cyp33 / 36984 | FlyBaseID: | FBgn0028382 | Length: | 300 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001004279.1 | Gene: | Ppid / 361967 | RGDID: | 1303174 | Length: | 370 | Species: | Rattus norvegicus |
Alignment Length: | 197 | Identity: | 106/197 - (53%) |
---|---|---|---|
Similarity: | 126/197 - (63%) | Gaps: | 25/197 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 PEGEPEAEKVETPSTGPAVIEKAEKRNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCT 176
Fly 177 HEQGYG--------YKGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTL 233
Fly 234 SMANSGANTNGSQFFICTTKTDWLDNKHVVFGHVISGAEVVRKMERCGSKSGTPSQKIVIYSCGE 298
Fly 299 LK 300 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cyp33 | NP_523773.1 | RRM_PPIE | 8..80 | CDD:240793 | |
cyclophilin_ABH_like | 139..297 | CDD:238907 | 97/165 (59%) | ||
Ppid | NP_001004279.1 | cyclophilin_ABH_like | 16..182 | CDD:238907 | 97/165 (59%) |
Chaperone activity. /evidence=ECO:0000250 | 185..215 | 1/1 (100%) | |||
3a0801s09 | 192..>330 | CDD:273380 | |||
Interaction with HSP90AB1. /evidence=ECO:0000250 | 214..370 | ||||
TPR repeat | 223..251 | CDD:276809 | |||
TPR repeat | 272..302 | CDD:276809 | |||
TPR repeat | 307..335 | CDD:276809 | |||
TPR repeat | 341..364 | CDD:276809 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0652 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |