DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and CG17266

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster


Alignment Length:168 Identity:91/168 - (54%)
Similarity:110/168 - (65%) Gaps:6/168 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 NPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQ-----GYGYKGCSFHRVIPEFMC 197
            ||.|||||.:|..:.||::..|.||.||:|||||||.||.|.     ..||||.||||||.:||.
  Fly    16 NPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMI 80

  Fly   198 QGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHV 262
            |||||...:|||..||||..|.||||.|||:|.|.|||||||..|||.||||...|.::||.|||
  Fly    81 QGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHV 145

  Fly   263 VFGHVISGAEVVRKMERCGS-KSGTPSQKIVIYSCGEL 299
            |||.|:.|..::||:|...: .:..|...:.|..||::
  Fly   146 VFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 88/163 (54%)
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 88/163 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447234
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.