DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and Cyp1

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster


Alignment Length:169 Identity:116/169 - (68%)
Similarity:133/169 - (78%) Gaps:2/169 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 KAEKRN--PQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEF 195
            ||.|.:  |:||||:.......|||||.||:|||||||||||.|||.|:|:||||..||||||.|
  Fly    59 KASKMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNF 123

  Fly   196 MCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNK 260
            |||||||||:||||||||||.||.||||.|||...|.|||||:|||||||||||||.||.|||||
  Fly   124 MCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNK 188

  Fly   261 HVVFGHVISGAEVVRKMERCGSKSGTPSQKIVIYSCGEL 299
            |||||.|:.|.:||:|:|..||:||..|:||::.:.|.|
  Fly   189 HVVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 111/157 (71%)
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 111/157 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447216
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D121127at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.