DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and cyp4

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_596532.1 Gene:cyp4 / 2541395 PomBaseID:SPBP8B7.25 Length:201 Species:Schizosaccharomyces pombe


Alignment Length:178 Identity:92/178 - (51%)
Similarity:115/178 - (64%) Gaps:16/178 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 GPAVIEKAEKRNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRV 191
            ||.|.:       .|:||::.|....||:.:.|....|||||||||.|.|.|:|:||:|..||||
pombe    22 GPKVTD-------TVYFDLQQGDEFLGRVTIGLFGKTVPKTAENFRALATGEKGFGYEGSIFHRV 79

  Fly   192 IPEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDW 256
            ||.||.||||.|..:|||||||||.:|.||||.|.|...|.|||||:|.::|||||||.|.||.|
pombe    80 IPNFMIQGGDITKGDGTGGKSIYGSRFPDENFKLSHQRPGLLSMANAGPDSNGSQFFITTVKTPW 144

  Fly   257 LDNKHVVFGHVISGAEVVRKMERCGSKSGT-----PSQKIVIYSCGEL 299
            ||..|||||.|:||.::|:|:    ||:.|     |.:.:.|...|:|
pombe   145 LDGHHVVFGEVLSGYDIVKKI----SKAETDNRDKPLEDVKIIKSGQL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 87/162 (54%)
cyp4NP_596532.1 cyclophilin 27..186 CDD:294131 87/169 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.