DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and SPBC428.12c

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_595190.1 Gene:SPBC428.12c / 2540852 PomBaseID:SPBC428.12c Length:116 Species:Schizosaccharomyces pombe


Alignment Length:94 Identity:42/94 - (44%)
Similarity:57/94 - (60%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNDKRTIYVGGLADEVTERLLNNAFIPFGDIADIQMPADYESQRHRGFAFIEYEQSEDAAAAID 65
            |...|.|::||.||..|||.||.|||||||:|..:.:... |....|.:||:|:::.|||..|::
pombe     1 MERRKATVHVGNLAPSVTESLLYNAFIPFGEIISVALHRK-EKAVDRSYAFVEFDEPEDAKEAME 64

  Fly    66 NMNDSELCGRTIRVNLAKPVRVKEDSFKP 94
            |||.|.||.|.|||:.|......|::..|
pombe    65 NMNYSILCDRCIRVSPANFALSAEETAVP 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793 35/71 (49%)
cyclophilin_ABH_like 139..297 CDD:238907
SPBC428.12cNP_595190.1 RRM_PPIE 8..79 CDD:240793 35/71 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I2780
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004615
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.