DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and ppi1

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_595664.1 Gene:ppi1 / 2540269 PomBaseID:SPBC28F2.03 Length:162 Species:Schizosaccharomyces pombe


Alignment Length:156 Identity:104/156 - (66%)
Similarity:114/156 - (73%) Gaps:0/156 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 FFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQGGDFTNNN 206
            |||:...|...||||..|..|||||||.|||.|||.|:||||.|.:||||||:||.||||||..|
pombe     5 FFDVIANGQPLGRIVFKLFDDVVPKTAANFRALCTGEKGYGYAGSTFHRVIPQFMLQGGDFTRGN 69

  Fly   207 GTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVVFGHVISGA 271
            |||||||||:||.||||.||||..|.|||||:|.|||||||||.|..|.|||.||||||.|..|.
pombe    70 GTGGKSIYGEKFPDENFALKHNKPGLLSMANAGPNTNGSQFFITTVVTPWLDGKHVVFGEVTEGM 134

  Fly   272 EVVRKMERCGSKSGTPSQKIVIYSCG 297
            :||:|:|..||.||....:|||..||
pombe   135 DVVKKVESLGSNSGATRARIVIDKCG 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 102/154 (66%)
ppi1NP_595664.1 cyclophilin_ABH_like 2..160 CDD:238907 102/154 (66%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.