DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and CG30350

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster


Alignment Length:196 Identity:43/196 - (21%)
Similarity:77/196 - (39%) Gaps:33/196 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 EAEKVETPSTGPAVIEKAEKR---NPQVFFDIRIGGNDA---GRIVMLLRADVVPKTAENFRQLC 175
            ||..:..|.:      .||.|   .|:::||:.:  .||   ||.|:.|..:..|.......:.|
  Fly   194 EAFNIPLPKS------DAELRRLFRPRIYFDLYL--KDARPLGRFVVQLYTEAAPLVVLQLIKSC 250

  Fly   176 THEQGYGYKGCSFH------RVIPEFMCQGGDFTNNNGTGGKSI-YGKKFNDENFNLKHNSFGTL 233
            .         |:.|      |:.|....:.....:::....:.: |..|..|...:....||   
  Fly   251 M---------CNQHSKFMVKRLFPNLWLETDLMLSSDSLLHQPLEYDAKVIDHGASSYVLSF--- 303

  Fly   234 SMANSGANTNGSQFFICTTKTDWLDNKHVVFGHVISGAEVVRKMERCGSKSGTPSQKIVIYSCGE 298
            |.|.....|:...|.|.......::...|.||.::.|:::...::..|:|:|..|:.::..|||.
  Fly   304 SKAYVTGFTHHLSFAISFKPLTVVNGSRVGFGRIVKGSKICECIQSYGTKNGKLSRGLLFTSCGL 368

  Fly   299 L 299
            |
  Fly   369 L 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 34/167 (20%)
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590
cyclophilin 212..369 CDD:294131 36/170 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.