DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and Ppig

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001074555.1 Gene:Ppig / 228005 MGIID:2445173 Length:752 Species:Mus musculus


Alignment Length:172 Identity:94/172 - (54%)
Similarity:113/172 - (65%) Gaps:9/172 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 RNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYG--------YKGCSFHRVIP 193
            :.|:.||||.|....|||:|..|.:||.|||.||||.|||.|:|.|        ||.|.||||:.
Mouse     6 QRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVK 70

  Fly   194 EFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLD 258
            :||.|||||:..||.||:||||..|.||:|.:|||....|||||.|.:||||||||.|..|..||
Mouse    71 DFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLD 135

  Fly   259 NKHVVFGHVISGAEVVRKMERCGSKSGT-PSQKIVIYSCGEL 299
            ..|||||.||||.||||::|...:.:.: |..::.|.|||||
Mouse   136 GHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGEL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 90/166 (54%)
PpigNP_001074555.1 cyclophilin 8..175 CDD:412213 90/166 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..752
PTZ00121 <401..750 CDD:173412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.