DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and cyn-12

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_501118.1 Gene:cyn-12 / 191627 WormBaseID:WBGene00000888 Length:169 Species:Caenorhabditis elegans


Alignment Length:142 Identity:68/142 - (47%)
Similarity:85/142 - (59%) Gaps:10/142 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 PQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQGGDFT 203
            |.|..|..:     |:|.:.|..:..|:|.:||.||.  ::.| |.|..|||:|.:||.||||.|
 Worm    10 PYVILDTTM-----GKIALELYWNHAPRTCQNFSQLA--KRNY-YNGTIFHRIIADFMIQGGDPT 66

  Fly   204 NNNGTGGKSIYGKKFNDE-NFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVVFGHV 267
             ..|.||.||||.||:|| :..|||...|.|||||:|.|||||||||....|..||.||.:||.|
 Worm    67 -GTGRGGASIYGDKFSDEIDERLKHTGAGILSMANAGPNTNGSQFFITLAPTQHLDGKHTIFGRV 130

  Fly   268 ISGAEVVRKMER 279
            .:|.:|:..|.|
 Worm   131 AAGMKVIANMGR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 68/142 (48%)
cyn-12NP_501118.1 cyclophilin_SpCYP2_like 13..159 CDD:238903 66/139 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.