DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and sig-7

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_492343.2 Gene:sig-7 / 172664 WormBaseID:WBGene00000890 Length:427 Species:Caenorhabditis elegans


Alignment Length:151 Identity:48/151 - (31%)
Similarity:76/151 - (50%) Gaps:14/151 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQGGDFTNNNGTGGKSIY--- 214
            |.:::.|.....|:.:.||.:||..:.   |....||.:...::.|.||.| ..|.||:|:|   
 Worm    10 GDLIIDLFVKERPRCSLNFLKLCKKKY---YNLNQFHSIERNYVAQTGDPT-GTGKGGESVYSDM 70

  Fly   215 ----GKKFNDENF-NLKHNSFGTLSMANSGANTNGSQFFICTTKT-DWLDNKHVVFGHVISGAEV 273
                |:.|..|:. .::|...|.:|..|:|.|..||||||...:. |:||::|.:||.|..|.|.
 Worm    71 YGEQGRYFEREDLPKMRHTRMGIVSFVNNGDNMLGSQFFITLGENLDYLDDQHTIFGQVTEGLET 135

  Fly   274 VRKM-ERCGSKSGTPSQKIVI 293
            :.|: |:....:..|.:.|.|
 Worm   136 LEKLNEQLADTNNRPFKDIRI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 48/151 (32%)
sig-7NP_492343.2 cyclophilin_RRM 4..169 CDD:238902 48/151 (32%)
RRM 128..>346 CDD:223796 8/29 (28%)
RRM_PPIL4 238..320 CDD:240681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.