DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and LOC1277821

DIOPT Version :10

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_061513413.1 Gene:LOC1277821 / 1277821 VectorBaseID:AGAMI1_014506 Length:714 Species:Anopheles gambiae


Alignment Length:123 Identity:48/123 - (39%)
Similarity:64/123 - (52%) Gaps:15/123 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 PKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYG-------KKFNDEN 222
            |:.|.||.:||..:. |.|.  .||.:..:|:.|.||.| ..|.||.|::|       :.|..|:
Mosquito    22 PRAALNFLKLCKLKY-YNYN--LFHTIQSDFIAQTGDPT-GAGDGGSSVWGILEGAEKRYFEGES 82

  Fly   223 F-NLKHNSFGTLSMANSGANTNGSQFFICTTKTDW--LDNKHVVFGHVISGAEVVRKM 277
            . .:||:..|.|||.|:|....|||||. |...|.  ||.:|.|.|.|..|.||:||:
Mosquito    83 VPKIKHSEPGLLSMVNAGEQLIGSQFFF-TLGPDLTSLDGRHTVIGEVTEGHEVLRKL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..82 CDD:409783
cyclophilin_ABH_like 139..297 CDD:238907 48/123 (39%)
LOC1277821XP_061513413.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.