DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and Moca-cyp

DIOPT Version :10

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_061502815.1 Gene:Moca-cyp / 1273012 VectorBaseID:AGAMI1_012454 Length:900 Species:Anopheles gambiae


Alignment Length:202 Identity:98/202 - (48%)
Similarity:122/202 - (60%) Gaps:28/202 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 GATLQPEGEPEAEKVETPSTGPAVIEKAEKRNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENF 171
            ||..:|. .|:.||:                  :.|||:.:||..|||||..|...|.|||.|||
Mosquito     9 GAAAEPP-PPQQEKI------------------RCFFDVSLGGLPAGRIVFELFPAVAPKTCENF 54

  Fly   172 RQLCTHEQGYG--------YKGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHN 228
            |.|||.|:|.|        |||..||||:.:||.|.|||:|.|||||:||||..|:||.|.|||:
Mosquito    55 RALCTGEKGIGQKTGKPLHYKGIIFHRVVKDFMIQSGDFSNGNGTGGESIYGGTFDDEEFTLKHD 119

  Fly   229 SFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVVFGHVISGAEVVRKMERCG-SKSGTPSQKIV 292
            ....|||||.|.|||||||||.|.....|||.|||||||:||.::||::|:.. .::..|.|..:
Mosquito   120 RAFLLSMANRGKNTNGSQFFITTQPAPHLDNVHVVFGHVVSGQDLVRQLEQLPVDRNSRPLQDAM 184

  Fly   293 IYSCGEL 299
            :.:||||
Mosquito   185 VSNCGEL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..82 CDD:409783
cyclophilin_ABH_like 139..297 CDD:238907 88/166 (53%)
Moca-cypXP_061502815.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.