DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and LOC100911252

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_038964534.1 Gene:LOC100911252 / 100911252 RGDID:6493676 Length:164 Species:Rattus norvegicus


Alignment Length:162 Identity:109/162 - (67%)
Similarity:122/162 - (75%) Gaps:0/162 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 NPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQGGDF 202
            ||.|||||...|...||:...|.||.|||||||||.|.|.|:|:||||.||||:||.||||||||
  Rat     3 NPTVFFDITADGEPLGRVCFELFADEVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDF 67

  Fly   203 TNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVVFGHV 267
            |.:||||||||||:||.||||.|||...|.|||||:|.|||||||||||.||:|||.||||||.|
  Rat    68 TCHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKV 132

  Fly   268 ISGAEVVRKMERCGSKSGTPSQKIVIYSCGEL 299
            ..|..:|..|||.||::|..|:||.|..||:|
  Rat   133 KEGMSIVEAMERFGSRNGKTSKKITISDCGQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 105/157 (67%)
LOC100911252XP_038964534.1 cyclophilin_ABH_like 4..162 CDD:238907 105/157 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.