DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and LOC100909955

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_038936344.1 Gene:LOC100909955 / 100909955 RGDID:6501070 Length:187 Species:Rattus norvegicus


Alignment Length:165 Identity:90/165 - (54%)
Similarity:109/165 - (66%) Gaps:0/165 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 AEKRNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQ 198
            ||..||.|:|:|...|...|.:...|.||.||||||||..|.|.|:|:|||..||||:||.||||
  Rat    22 AELVNPTVYFNITADGEPLGHVSFELFADNVPKTAENFHALSTGEKGFGYKASSFHRIIPGFMCQ 86

  Fly   199 GGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVV 263
            ||:.|.:||.||:|||.:||..|:..|||...|.|||||...||:||||||||.||:||..|.||
  Rat    87 GGNVTCHNGAGGRSIYREKFEGEDVILKHTGPGILSMANDEPNTSGSQFFICTAKTEWLGGKGVV 151

  Fly   264 FGHVISGAEVVRKMERCGSKSGTPSQKIVIYSCGE 298
            |.....|..:|..|||.||::|..|::|.|..||:
  Rat   152 FEKAKDGMNIVEAMERFGSRNGKTSKQITISGCGQ 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 85/157 (54%)
LOC100909955XP_038936344.1 cyclophilin 27..185 CDD:412213 85/157 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D563773at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.