DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and ppic

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_002931773.2 Gene:ppic / 100494684 XenbaseID:XB-GENE-948735 Length:208 Species:Xenopus tropicalis


Alignment Length:172 Identity:96/172 - (55%)
Similarity:116/172 - (67%) Gaps:8/172 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 GPAVIEKAEKRNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRV 191
            ||.|..|       |||::.|||.||||||:.|...|||||.:||..|.|.|:||||||..||||
 Frog    27 GPVVTAK-------VFFNVEIGGTDAGRIVIGLFGKVVPKTVKNFVALATGEKGYGYKGSRFHRV 84

  Fly   192 IPEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDW 256
            |.:||.||||.||.:|||||||||:.|.||||.|||...|.:||||:|.:||||||||.||:..|
 Frog    85 IKDFMIQGGDVTNGDGTGGKSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFISTTRPLW 149

  Fly   257 LDNKHVVFGHVISGAEVVRKME-RCGSKSGTPSQKIVIYSCG 297
            |:.||||||.|:.|..||..:| :..::...|.:..||.:.|
 Frog   150 LNGKHVVFGKVLEGMAVVHLIELQQTNERDQPLKDCVIVNSG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 91/158 (58%)
ppicXP_002931773.2 cyclophilin 33..191 CDD:294131 92/164 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.