DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and LOC100488106

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_004912407.1 Gene:LOC100488106 / 100488106 -ID:- Length:147 Species:Xenopus tropicalis


Alignment Length:133 Identity:99/133 - (74%)
Similarity:111/133 - (83%) Gaps:0/133 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYGKK 217
            |.|:|.||:|||||||||||.|||||:|:|||...|||:|||||||||||||:||||||||||.|
 Frog     2 GLIIMELRSDVVPKTAENFRALCTHEKGFGYKNSGFHRIIPEFMCQGGDFTNHNGTGGKSIYGNK 66

  Fly   218 FNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVVFGHVISGAEVVRKMERCGS 282
            |.||||.|:|...|.|||||:|||||||||||||.||.|||.||||||.||.|.:||:..|:.||
 Frog    67 FADENFQLRHTGPGILSMANAGANTNGSQFFICTAKTSWLDGKHVVFGTVIDGMDVVKNTEKLGS 131

  Fly   283 KSG 285
            :||
 Frog   132 QSG 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 99/133 (74%)
LOC100488106XP_004912407.1 cyclophilin 2..134 CDD:294131 97/131 (74%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D563773at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.