DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp33 and Nktr

DIOPT Version :9

Sequence 1:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_038938667.1 Gene:Nktr / 100364165 RGDID:2321593 Length:1516 Species:Rattus norvegicus


Alignment Length:180 Identity:85/180 - (47%)
Similarity:107/180 - (59%) Gaps:9/180 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 AVIEKAEKRNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYG--------YKG 185
            |.:....:..||..|||.|.....|||:..|.:|:.|||.:||..||:.|:|.|        |||
  Rat    56 AALAMGAQDRPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKG 120

  Fly   186 CSFHRVIPEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFIC 250
            .:||||:..||.|||||:..||.||:||||..|.||||.|||:....|||||.|.:||||||||.
  Rat   121 STFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFIT 185

  Fly   251 TTKTDWLDNKHVVFGHVISGAEVVRKMERCGSKSGT-PSQKIVIYSCGEL 299
            |.....||..|||||.||||.||:.::|...:.:.: |...:.:..||.|
  Rat   186 TKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 81/166 (49%)
NktrXP_038938667.1 cyclophilin 66..233 CDD:412213 81/166 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.