DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4866 and IMP3

DIOPT Version :9

Sequence 1:NP_611224.1 Gene:CG4866 / 36976 FlyBaseID:FBgn0034232 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_012018.1 Gene:IMP3 / 856553 SGDID:S000001191 Length:183 Species:Saccharomyces cerevisiae


Alignment Length:186 Identity:100/186 - (53%)
Similarity:134/186 - (72%) Gaps:13/186 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRKLKFHEQKLLKKVDFITWKVDNGGKENKILRRFHIQKREDYTKYNKLSREIRELAERIAKLD 65
            ||||||.|||||||||||:.||.|.|.::.:::|.:|||.||||.|||::..:||.||.:::.|.
Yeast     1 MVRKLKHHEQKLLKKVDFLEWKQDQGHRDTQVMRTYHIQNREDYHKYNRICGDIRRLANKLSLLP 65

  Fly    66 ASEPFKTEATTMLLNKLHAMGVSNDQLTLETAAKIS-------ASHFCRRRLPVIMVKLRMSEHL 123
            .::||:.:...:||:||:||||      |.|.:|||       .|..|||||||||.:|:|:|.:
Yeast    66 PTDPFRRKHEQLLLDKLYAMGV------LTTKSKISDLENKVTVSAICRRRLPVIMHRLKMAETI 124

  Fly   124 KAATDLIEHGHVRVGPEMIKDPAFLVSRNLEDFVTWVDGSKIKEHVLRYNDMRDDF 179
            :.|...||.|||||||.:|.|||:||:||:||:|||||.||||:.:|||.:..|||
Yeast   125 QDAVKFIEQGHVRVGPNLINDPAYLVTRNMEDYVTWVDNSKIKKTLLRYRNQIDDF 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4866NP_611224.1 RpsD 1..>166 CDD:223596 92/171 (54%)
S4 108..154 CDD:279780 28/45 (62%)
IMP3NP_012018.1 RpsD 1..>177 CDD:223596 97/181 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346759
Domainoid 1 1.000 79 1.000 Domainoid score I2051
eggNOG 1 0.900 - - E1_COG0522
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6120
Inparanoid 1 1.050 202 1.000 Inparanoid score I850
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53817
OrthoFinder 1 1.000 - - FOG0004591
OrthoInspector 1 1.000 - - oto99332
orthoMCL 1 0.900 - - OOG6_102070
Panther 1 1.100 - - LDO PTHR11831
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R609
SonicParanoid 1 1.000 - - X3205
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.