DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4866 and RPS9A

DIOPT Version :9

Sequence 1:NP_611224.1 Gene:CG4866 / 36976 FlyBaseID:FBgn0034232 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_015244.1 Gene:RPS9A / 856024 SGDID:S000006002 Length:197 Species:Saccharomyces cerevisiae


Alignment Length:140 Identity:37/140 - (26%)
Similarity:67/140 - (47%) Gaps:9/140 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ENKILRRFHIQ-KREDYT---KYNKLSREIRELAERIAKLDASEPFKTEATTMLLNKLHAMGV-S 88
            |.|:...|.:: |:|.|.   :.:|:.|..|:|..|    |..:|.:......|:.:|..:|| |
Yeast    27 ELKLAGEFGLKNKKEIYRISFQLSKIRRAARDLLTR----DEKDPKRLFEGNALIRRLVRVGVLS 87

  Fly    89 NDQLTLETAAKISASHFCRRRLPVIMVKLRMSEHLKAATDLIEHGHVRVGPEMIKDPAFLVSRNL 153
            .|:..|:....:....|..|||...:.||.:::.:..|..||...|:.||.:::..|:|:|..:.
Yeast    88 EDKKKLDYVLALKVEDFLERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDS 152

  Fly   154 EDFVTWVDGS 163
            |..:.:...|
Yeast   153 EKHIDFAPTS 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4866NP_611224.1 RpsD 1..>166 CDD:223596 37/140 (26%)
S4 108..154 CDD:279780 14/45 (31%)
RPS9ANP_015244.1 PTZ00155 1..181 CDD:185484 37/140 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0522
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.