DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4866 and Rps9

DIOPT Version :9

Sequence 1:NP_611224.1 Gene:CG4866 / 36976 FlyBaseID:FBgn0034232 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_084043.1 Gene:Rps9 / 76846 MGIID:1924096 Length:194 Species:Mus musculus


Alignment Length:123 Identity:29/123 - (23%)
Similarity:62/123 - (50%) Gaps:1/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KENKILRRFHIQKREDYTKYNKLSREIRELAERIAKLDASEPFKTEATTMLLNKLHAMGVSND-Q 91
            :|.|::..:.::.:.:..:......:||:.|..:..||..:|.:......||.:|..:||.:: :
Mouse    27 QELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGK 91

  Fly    92 LTLETAAKISASHFCRRRLPVIMVKLRMSEHLKAATDLIEHGHVRVGPEMIKDPAFLV 149
            :.|:....:....|..|||...:.||.:::.:..|..||...|:||..:::..|:|:|
Mouse    92 MKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIV 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4866NP_611224.1 RpsD 1..>166 CDD:223596 29/123 (24%)
S4 108..154 CDD:279780 14/42 (33%)
Rps9NP_084043.1 PTZ00155 11..177 CDD:185484 29/123 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..194
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0522
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.