DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4866 and imp3

DIOPT Version :9

Sequence 1:NP_611224.1 Gene:CG4866 / 36976 FlyBaseID:FBgn0034232 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001278286.1 Gene:imp3 / 393237 ZFINID:ZDB-GENE-040426-1062 Length:183 Species:Danio rerio


Alignment Length:181 Identity:115/181 - (63%)
Similarity:148/181 - (81%) Gaps:0/181 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRKLKFHEQKLLKKVDFITWKVDNGGKENKILRRFHIQKREDYTKYNKLSREIRELAERIAKLD 65
            |||||||||||||||||||.|:|||...|.|:||::||:|||||||||||||.|||||::|..||
Zfish     1 MVRKLKFHEQKLLKKVDFINWEVDNNIHEVKVLRKYHIEKREDYTKYNKLSRNIRELAQKIRDLD 65

  Fly    66 ASEPFKTEATTMLLNKLHAMGVSNDQLTLETAAKISASHFCRRRLPVIMVKLRMSEHLKAATDLI 130
            |.:.|::::|.:.|.||:::|:...:..|..|.::|||.|||||||.||:||||:::|:.|...|
Zfish    66 AKDGFRSQSTALFLEKLYSVGLIPTKQNLSLANEVSASAFCRRRLPTIMLKLRMAQNLRNAITFI 130

  Fly   131 EHGHVRVGPEMIKDPAFLVSRNLEDFVTWVDGSKIKEHVLRYNDMRDDFQM 181
            |.||:|||||:|.||||||:||:||||||||.||||:||:.||:.||||.:
Zfish   131 EQGHIRVGPEVITDPAFLVTRNMEDFVTWVDSSKIKQHVMNYNEERDDFDL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4866NP_611224.1 RpsD 1..>166 CDD:223596 105/164 (64%)
S4 108..154 CDD:279780 30/45 (67%)
imp3NP_001278286.1 RpsD 1..177 CDD:223596 111/175 (63%)
Ribosomal_S4 5..55 CDD:278588 38/49 (78%)
S4 108..154 CDD:279780 30/45 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596708
Domainoid 1 1.000 97 1.000 Domainoid score I7204
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6120
Inparanoid 1 1.050 245 1.000 Inparanoid score I3269
OMA 1 1.010 - - QHG53817
OrthoDB 1 1.010 - - D1336285at2759
OrthoFinder 1 1.000 - - FOG0004591
OrthoInspector 1 1.000 - - oto41741
orthoMCL 1 0.900 - - OOG6_102070
Panther 1 1.100 - - LDO PTHR11831
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R609
SonicParanoid 1 1.000 - - X3205
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.