DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4866 and Imp3

DIOPT Version :9

Sequence 1:NP_611224.1 Gene:CG4866 / 36976 FlyBaseID:FBgn0034232 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001101622.1 Gene:Imp3 / 315697 RGDID:1306825 Length:184 Species:Rattus norvegicus


Alignment Length:182 Identity:105/182 - (57%)
Similarity:144/182 - (79%) Gaps:1/182 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRKLKFHEQKLLKKVDFITWKV-DNGGKENKILRRFHIQKREDYTKYNKLSREIRELAERIAKL 64
            ||||||||||||||:|||:.|:| |:...|.::|||:.:|:||:||:||:|||.:||||.|:..|
  Rat     1 MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYGLQRREEYTRYNQLSRAVRELARRLRDL 65

  Fly    65 DASEPFKTEATTMLLNKLHAMGVSNDQLTLETAAKISASHFCRRRLPVIMVKLRMSEHLKAATDL 129
            ...:||:..|:..||:||:|:|:...:.:||....:|||.|||||||.:::||||::||:||...
  Rat    66 PERDPFRVRASAALLDKLYALGLVPTRGSLELCDSVSASSFCRRRLPTLLLKLRMAQHLQAAVAF 130

  Fly   130 IEHGHVRVGPEMIKDPAFLVSRNLEDFVTWVDGSKIKEHVLRYNDMRDDFQM 181
            :|.|||||||:::.||||||:|::||||||||.||||.|||.||:.||||.:
  Rat   131 VEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4866NP_611224.1 RpsD 1..>166 CDD:223596 94/165 (57%)
S4 108..154 CDD:279780 27/45 (60%)
Imp3NP_001101622.1 RpsD 1..>168 CDD:223596 95/166 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354407
Domainoid 1 1.000 79 1.000 Domainoid score I8485
eggNOG 1 0.900 - - E1_COG0522
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6120
Inparanoid 1 1.050 225 1.000 Inparanoid score I3414
OMA 1 1.010 - - QHG53817
OrthoDB 1 1.010 - - D1336285at2759
OrthoFinder 1 1.000 - - FOG0004591
OrthoInspector 1 1.000 - - oto96418
orthoMCL 1 0.900 - - OOG6_102070
Panther 1 1.100 - - LDO PTHR11831
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3205
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.