DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4866 and imp3

DIOPT Version :9

Sequence 1:NP_611224.1 Gene:CG4866 / 36976 FlyBaseID:FBgn0034232 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_594903.1 Gene:imp3 / 2542514 PomBaseID:SPAC19D5.05c Length:183 Species:Schizosaccharomyces pombe


Alignment Length:184 Identity:96/184 - (52%)
Similarity:132/184 - (71%) Gaps:6/184 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VRKLKFHEQKLLKKVDFITWK-VDNGGKENKILRRFHIQKREDYTKYNKLSREIRELAERIAKLD 65
            :|.||.||||||:||||:.:| .||..::..::||:||.|||:|.|||.:..:.|:||.|::.||
pombe     1 MRILKHHEQKLLRKVDFLNYKNDDNNHRDVMVMRRYHISKREEYQKYNIICGKFRQLAHRLSLLD 65

  Fly    66 ASEPFKTEATTMLLNKLHAMGV--SNDQLT-LETAAKISASHFCRRRLPVIMVKLRMSEHLKAAT 127
            .::||:.:...:||.||..||:  |..::: :|..|.:||  .|||||||||.|||||:.:..||
pombe    66 PTDPFRLQYENLLLEKLFDMGILPSKSKMSDIENKANVSA--ICRRRLPVIMCKLRMSQVVSEAT 128

  Fly   128 DLIEHGHVRVGPEMIKDPAFLVSRNLEDFVTWVDGSKIKEHVLRYNDMRDDFQM 181
            .|||.|||||||.:|.|||:||:|:|||||||.|.||||..:.:|||..||:.:
pombe   129 RLIEQGHVRVGPHVITDPAYLVTRSLEDFVTWTDTSKIKRTIAKYNDKLDDYDL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4866NP_611224.1 RpsD 1..>166 CDD:223596 89/167 (53%)
S4 108..154 CDD:279780 31/45 (69%)
imp3NP_594903.1 RpsD 1..>177 CDD:223596 94/177 (53%)
Ribosomal_S4 4..64 CDD:278588 30/59 (51%)
S4 109..155 CDD:279780 31/45 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I2839
eggNOG 1 0.900 - - E1_COG0522
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6120
Inparanoid 1 1.050 186 1.000 Inparanoid score I1072
OMA 1 1.010 - - QHG53817
OrthoFinder 1 1.000 - - FOG0004591
OrthoInspector 1 1.000 - - oto100908
orthoMCL 1 0.900 - - OOG6_102070
Panther 1 1.100 - - LDO PTHR11831
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R609
SonicParanoid 1 1.000 - - X3205
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.