DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4866 and C48B6.2

DIOPT Version :9

Sequence 1:NP_611224.1 Gene:CG4866 / 36976 FlyBaseID:FBgn0034232 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_491972.1 Gene:C48B6.2 / 172420 WormBaseID:WBGene00016740 Length:183 Species:Caenorhabditis elegans


Alignment Length:181 Identity:90/181 - (49%)
Similarity:130/181 - (71%) Gaps:0/181 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRKLKFHEQKLLKKVDFITWKVDNGGKENKILRRFHIQKREDYTKYNKLSREIRELAERIAKLD 65
            ||||||.||||||||.||::|:||..||:..:||:|:::|||.|..||.|:.:.||:|:.|..|.
 Worm     1 MVRKLKTHEQKLLKKTDFMSWQVDQQGKQGDMLRKFYVKKREHYALYNTLAAKSREVADLIKNLS 65

  Fly    66 ASEPFKTEATTMLLNKLHAMGVSNDQLTLETAAKISASHFCRRRLPVIMVKLRMSEHLKAATDLI 130
            .|:||:::.|..:|.|.:|.|:.....|||...|::.:.|.||||||:|..:.|.|.:|.|:||:
 Worm    66 ESDPFRSKCTEDMLTKFYAAGLVPTSDTLERIGKVTGASFARRRLPVVMRNIGMCESVKTASDLV 130

  Fly   131 EHGHVRVGPEMIKDPAFLVSRNLEDFVTWVDGSKIKEHVLRYNDMRDDFQM 181
            |.||||:|.:::.||||:|:|:.||.:||...||||:||:.||:.||||.:
 Worm   131 EQGHVRIGTKLVTDPAFMVTRSSEDMITWTKASKIKKHVMDYNNTRDDFDL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4866NP_611224.1 RpsD 1..>166 CDD:223596 80/164 (49%)
S4 108..154 CDD:279780 24/45 (53%)
C48B6.2NP_491972.1 RpsD 1..>167 CDD:223596 81/165 (49%)
S4 108..157 CDD:279780 26/48 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167787
Domainoid 1 1.000 72 1.000 Domainoid score I6087
eggNOG 1 0.900 - - E1_COG0522
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6120
Inparanoid 1 1.050 196 1.000 Inparanoid score I2516
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53817
OrthoDB 1 1.010 - - D1336285at2759
OrthoFinder 1 1.000 - - FOG0004591
OrthoInspector 1 1.000 - - oto19767
orthoMCL 1 0.900 - - OOG6_102070
Panther 1 1.100 - - LDO PTHR11831
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R609
SonicParanoid 1 1.000 - - X3205
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.